Prof. em. Dr. rer. nat. habil. Sigismund Kobe

Kobe Porträt 2015 © Kobe 2015 Kobe Porträt 2015 © Kobe 2015
Kobe Porträt 2015

© Kobe 2015

CV

  • 1940                  geboren in Zella-Mehlis
  • 1959-1965        Studium Kernphysik und Physik (TH/TU Dresden)
  • 1965-1992        Assistent, Lehrer im Hochschuldienst und Oberassistent                              (Sektion Physik, TU Dresden)
  • 1971                  Dr. rer. nat. (TU Dresden)
  • 1988                  Dr. sc. nat. (TU Dresden)
  • 1991                  Dr. rer. nat. habil. (TU Dresden)
  • 1992                  Professor für Theorie ungeordneter Festkörper am Institut für                                           Theoretische Physik, TU Dresden
  • 2006                  Emeritierung

BOOKS

  • K. Handrich, S. Kobe                                                                                                      Amorphe Ferro- und Ferrimagnetika                                                                              Akademie-Verlag Berlin 1980, 250 S.                                                                            Physik-Verlag Weinheim 1980 (Lizenzausgabe)                                                                      Übersetzung in die Russische Sprache (N.N. Potapova):                                       Amorfnye ferro- i ferrimagnetiki                                                                                         Mir Moskva 1982
  • A.R. Ferchmin, S. Kobe                                                                                            Amorphous Magnetism and Metallic Magnetic Materials Digest                              (Series of monographs on selected topics in solid state physics,                                    Vol. XVII, Ed. E.P. Wohlfarth)                                                                                           North-Holland Amsterdam, New York, Oxford 1983, 354 p.

Publications up to 1989 (selected papers)

(source of citation: ISI Web of science, without self–citations)

Publications 1990–2008

LECTURES

Former co–workers

Dr. T. Klotz

Dissertation 1996
Zur Phasenraumstruktur in ungeordneten +/– Ising–Spinsystemen

S. Neef

Diplomarbeit 2001

Dr. J. Krawczyk

Dissertation 2003
Struktur der Energielandschaft und Relaxation von +–J Spinglas–Modellen

Dr. F. Dressel

Dissertation 2008
Sequenz, Energie, Struktur – Untersuchungen zur Beziehung zwischen Primär– und Tertiärstruktur in globulären und Membran-Proteinen

Teaching

  • Experimentalphysik 1 für Physiker                                                                Wintersemester 1992/1993
  • Theoretische Physik 2 für Berufspädagogen                                                Wintersemester 1992/1993
  • Theoretische Mechanik 1 für Physiklehrer                                                     Wintersemester 1994/1995; 1995/1996; 1996/1997
  • Mechanik 2 für Physiklehrer                                                                       Sommersemester 1996
  • Thermodynamik für Gymnasiallehrer                                                       Sommersemester 1996
  • Thermodynamik und Statistische Physik für Physiklehrer                      Wintersemester 1997/1998; 1998/1999; 2004/2005
  • Quantenphysik für Physiklehrer                                                                 Sommersemester 2000, 2001, 2002, 2003, 2004 und 2005
  • Theoretische Mechanik für Physiker                                                             Wintersemester 1996/1997
  • Thermodynamik und Statistische Physik 2                                               Sommersemester 1995, 1997 und 1999
  • Thermodynamik und Statistik                                                                         Wintersemester 1998/1999; 1999/2000
  • Elektrodynamik                                                                                                 Wintersemester 2000/2001 und 2005/2006
  • Vielteilchensysteme                                                                                         Wintersemester 2001/2002; 2002/2003; 2003/2004
  • Brückenkurs Physik für Studienanfänger aller Fachrichtungen                              18.09.-29.09.1995; 16.09.-27.09.1996; 22.09.-02.10.1997; 28.09.-09.10.1998;         27.09.-08.10.1999; 25.09.-06.10.2000; 24.09-05.10.2001; 30.09.-11.10.2002;          29.09.-10.10.2003; 27.09.-05.10.2004; 26.09.-07.10.2005
  • Brückenkurs Physik 2006
  • Elektrodynamik WS 2005/2006
  • Technische Neuroinformatik - Physikalische Grundlagen und Modelle     Wintersemester 1997/1998; 1998/1999; 1999/2000 (einschl. Studium generale);
    2000/2001; 2001/2002; 2003/2004; 2004/2005; 2005/2006; 2007/2008
  • Theorie ungeordneter Festkörper                                                                 Wintersemester 1997/1998
  • Ringvorlesung "Naturwissenschaft und Gesellschaft"                               Neuroinformatik - das Gehirn als Vorbild (1 Vorl. im Wintersemester 1996/1997)
  • Applet Neuronale Netze
  • Themen für Abschlußarbeiten:
    • Interessante Resultate mit einfachen Modellen der theoretischen Physik
    • Computersimulationen: "Rechnen, was zuvor noch nicht gerechnet und denken, was zuvor noch nicht gedacht"
    Konkret geht es hierbei um die Vorhersage der räumlichen Struktur von Proteinen aus der sogenannten Primärstruktur (d.h. der Sequenz der Aminosäuren; letztere werden durch die Buchstaben A R N D C Q E G H I L K M F P S T W Y V codiert, dabei steht A für Alanin, R für Arginin, ... V für Valin).

    Ein Beispiel:
    Primärstruktur für Epithermal Growth Factor (EGF), eines Liganden im Signalweg der Zellteilung:
    NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
    Berechnete räumliche Struktur mit Hilfe eines "coarse grained" Proteinmodells (tubes) im Vergleich mit dem experimentellen Resultat (sticks):

  • https://www.physik.tu-dresden.de/itp/members/kobe/1jl9.jpg

EFG Protein © ITP Kobe EFG Protein © ITP Kobe
EFG Protein

© ITP Kobe

Research

Teaching and Research

  • Theory of magnetism in amorphous materials
  • Exact ground states and energy landscapes of the Ising model and related models with frustration using methods of global optimizations;
    Applications to spin glasses, neural networks and proteins

Other Publications


Rückblick auf TU-Initiativen beim Neubeginn
in: Der Neubeginn 1989 - Würdigung von TU-Initiativen zur Hochschulerneuerung zwischen 1989 und 1993 in Sachsen,
Festveranstaltung am 14. Oktober 2003 (175 Jahre Technische Universität Dresden), Sammlung der Reden und Beiträge,
Herausgeber: A. Post, Kanzler der TU Dresden, ISBN 3-86005-445-7 (2004) S. 46-71.

S. Kobe
Statistik seltener Ereignisse
Über die Effizienz von Präventivmaßnahmen zur Verringerung des Restrisikos von "school-shooting"-Attentaten nach Winnenden aus mathematischer Sicht
Forum Kriminalprävention 4/2009, S. 7-9

S. Kobe
Sind die "Erneuerbaren" wirklich erneuerbar?
Dresdner Universitätsjournal 22 (2011), Heft 14, S. 5

S. Kobe
Jahresprognose 2013 und Mittelfristprognose bis 2020 zur Stromerzeugung in Deutschland und Vergleich mit den Vorgaben der "Leitstudie 2010" (Stand: 01.07.2013)
in: QUCOSA, http://nbn-resolving.de/urn:nbn:de:bsz:14-qucosa-119334
http://www.schattenblick.de/infopool/umwelt/meinunge/umsp0443.html

S. Kobe
Bericht aus der Kommandozentrale
Strom an einem Sonntag im Hochsommer
ew - Magazin für Energiewirtschaft, ew 13/2013, S. 24

S. Kobe
Jahresprognose 2013: Erreicht Deutschland die Ziele der "Leitstudie 2010"?
Energiewirtschaftliche Tagesfragen 63 (2013) Heft 12, S. 55-57

S. Kobe                                                                                                                                  Umgang mit Fakten: Größte Sorgfalt ist geboten                                                            Dresdner Universitätsjournal 28 (2017), Heft 14, S. 6                                                     https://tu-dresden.de/tu-dresden/newsportal/ressourcen/dateien/universitaetsjournal/uj_pdfs/uj_2017/UJ14-17.pdf?lang=de

Vorträge (sonstige):

S. Kobe
Parteifeindliche Plattform an der TU Dresden im Jahre 1963
TU Dresden, Tagung am 30 November 2009
"Politisch motivierte Urteile und andere Formen von Repressionen gegen Studenten der TH/TU Dresden in der DDR"

S. Kobe
Statistics beyond physics - misused in public?
CompPhys10, 11th International NTZ-Workshop on New Developments in Computational Physics, 25 - 27 Nov. 2010, Universität Leipzig
(lecture notes)

S. Kobe
Sind erneuerbare Energien wirklich erneuerbar?
Ringvorlesung "Naturwissenschaften aktuell", Wintersemester 2012/2013, 31.01.2013,  TU Dresden
( Vortragsfolien, Quellenangaben )                                                                                          Volkshochschule Suhl, A Politik, Gesellschaft, Umwelt/ A9 Umweltbildung, A 9.01,         02. September 2013

S. Kobe
Energiewende im Konflikt zwischen Anspruch und Wirklichkeit
Bundesverband LANDSCHAFTSSCHUTZ e.V., Landesverband SACHSEN, 11.07.2013, Gut Gamig
(Vortragsfolien)

S. Kobe                                                                                                                                         Zum guten Schluß: "Mission erfüllt" und neue Herausforderungen                             Kommentar zur Auflösung des "Bundes Freiheit der Wissenschaften" am 17.11.2015 www.bund-freiheit-der-wissenschaften.de                                                                      Auszug:                                                                                                                                           "... Auf dem 39. Bildungspolitischen Forum zog der Gründungsvorsitzende Prof. Dr. Hans Maier ein eindrucksvolles Resümee der 45-jährigen Tätigkeit des Bundes. Mit den Worten "Mission erfüllt" wies er darauf hin, dass es gelungen ist, eine offene Einmischung durch ideologisch motivierte Einflussnahme abzuwehren. Die Freiheit der Wissenschaft ist jedoch auch weiterhin bedroht. Die Methoden haben sich allerdings geändert. Wir haben es zunehmend mit Versuchen zu tun, die Wissenschaft von innen heraus ideologisch zu unterwandern. Die für den Staat sehr angenehme `finanzielle Entpflichtung` durch mehr und mehr ausufernde Fokussierung auf Drittmittel-Einwerbung führt schleichend zum Verlust der Unabhängigkeit der Wissenschaft. Wissenschaftliche Gutachten und Studien werden im Unterbewusstsein oder sogar bewusst durch die Wünsche des Auftraggebers beeinflusst und danach einer kritischen Beurteilung einer wissenschaftlichen Community entzogen. Die Auswirkungen auf die Gesellschaft sind verheerend. Die Unterwanderung hat längst schon in Institutionen Einzug gehalten, deren vordringliche Aufgabe es eigentlich wäre, allgemein gültige Regeln und Normen wissenschaftlichen Arbeitens einzuhalten..."

S. Kobe                                                                                                                                    Statistik in der Öffentlichkeit - Kann man Zahlen vertrauen?                                                  TU Dresden, Bereich Mathematik und Naturwissenschaften, Ringvorlesung "Naturwissenschaften aktuell", Dresden, 03.12.2015                                                   Dresdner SENIORENAKADEMIE Wissenschaft und Kunst – Sommersemester 2016
22.09.2016                                                                                                                Volkshochschule Dresden, Zeitgeschehen und Politik, Frühjahr/Sommer 2017, 17F 1111
11.05.2017

                                                                                                                      S.Kobe                                                                                                                                             Die Energiewende in Deutschland im Konflikt zwischen Anspruch und Wirklichkeit          4. Windkraftforum, Thüringer Landtag, Erfurt, 4. April 2017                                         (livestream 47 min ab min 59:00)                                                                                      Dresdner SENIORENAKADEMIE Wissenschaft und Kunst, S - 02, 30. Mai 2017

Interview

in:                                                                                                                                          Windkraft im Vogtland: Der Verlust der Heimat                                                                     MDR, in: artour am 02.03.2017 (5:46 min)                                                                             Autor: Volker Insel
https://www.youtube.com/watch?v=jGDRGVaBItk

                                     

Zu dieser Seite

Webadministration
Letzte Änderung: 22.09.2017